Recombinant Human CLIC4 Protein, GST-tagged
Cat.No. : | CLIC4-1481H |
Product Overview : | Human CLIC4 full-length ORF (BAG37528.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008] |
Molecular Mass : | 54.23 kDa |
AA Sequence : | MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLIC4 chloride intracellular channel 4 [ Homo sapiens ] |
Official Symbol | CLIC4 |
Synonyms | CLIC4; chloride intracellular channel 4; chloride intracellular channel protein 4; CLIC4L; DKFZP566G223; H1; huH1; p64H1; P64H1; chloride intracellular channel 4 like; intracellular chloride ion channel protein p64H1; MTCLIC; FLJ38640; DKFZp566G223; |
Gene ID | 25932 |
mRNA Refseq | NM_013943 |
Protein Refseq | NP_039234 |
MIM | 606536 |
UniProt ID | Q9Y696 |
◆ Recombinant Proteins | ||
RFL19545BF | Recombinant Full Length Bovine Chloride Intracellular Channel Protein 4(Clic4) Protein, His-Tagged | +Inquiry |
CLIC4-11327H | Recombinant Human CLIC4 protein, GST-tagged | +Inquiry |
Clic4-2190M | Recombinant Mouse Clic4 Protein, Myc/DDK-tagged | +Inquiry |
CLIC4-3426H | Recombinant Human CLIC4 protein, His-tagged | +Inquiry |
CLIC4-3968H | Recombinant Human CLIC4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIC4-7446HCL | Recombinant Human CLIC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLIC4 Products
Required fields are marked with *
My Review for All CLIC4 Products
Required fields are marked with *