Recombinant Human CLIC4 Protein, GST-tagged

• Cat.No.: CLIC4-1481H
• Product Overview: Human CLIC4 full-length ORF (BAG37528.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008]
• Molecular Mass: 54.23 kDa
• AA Sequence: MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLIC4 chloride intracellular channel 4 [ Homo sapiens ]
• Official Symbol: CLIC4
• Synonyms: CLIC4; chloride intracellular channel 4; chloride intracellular channel protein 4; CLIC4L; DKFZP566G223; H1; huH1; p64H1; P64H1; chloride intracellular channel 4 like; intracellular chloride ion channel protein p64H1; MTCLIC; FLJ38640; DKFZp566G223
• Gene ID: 25932
• mRNA Refseq: NM_013943
• Protein Refseq: NP_039234
• MIM: 606536
• UniProt ID: Q9Y696