Recombinant Human CLNS1A Protein, GST-tagged

Cat.No. : CLNS1A-1509H
Product Overview : Human CLNS1A full-length ORF ( NP_001284, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]
Molecular Mass : 51.7 kDa
AA Sequence : MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLNS1A chloride channel, nucleotide-sensitive, 1A [ Homo sapiens ]
Official Symbol CLNS1A
Synonyms CLNS1A; chloride channel, nucleotide-sensitive, 1A; CLCI; methylosome subunit pICln; ICln; i(Cln); reticulocyte pICln; reticulocyte protein ICln; chloride channel regulatory protein; chloride ion current inducer protein; chloride channel, nucleotide sensitive 1A; chloride conductance regulatory protein ICln; CLNS1B;
Gene ID 1207
mRNA Refseq NM_001293
Protein Refseq NP_001284
MIM 602158
UniProt ID P54105

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLNS1A Products

Required fields are marked with *

My Review for All CLNS1A Products

Required fields are marked with *

0
cart-icon