Recombinant Human CLNS1A protein, GST-tagged
| Cat.No. : | CLNS1A-3743H |
| Product Overview : | Recombinant Human CLNS1A protein(1-237 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 31, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-237 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CLNS1A chloride channel, nucleotide-sensitive, 1A [ Homo sapiens ] |
| Official Symbol | CLNS1A |
| Synonyms | CLNS1A; chloride channel, nucleotide-sensitive, 1A; CLCI; methylosome subunit pICln; ICln; i(Cln); reticulocyte pICln; reticulocyte protein ICln; chloride channel regulatory protein; chloride ion current inducer protein; chloride channel, nucleotide sensitive 1A; chloride conductance regulatory protein ICln; CLNS1B; |
| Gene ID | 1207 |
| mRNA Refseq | NM_001293 |
| Protein Refseq | NP_001284 |
| MIM | 602158 |
| UniProt ID | P54105 |
| ◆ Recombinant Proteins | ||
| CLNS1A-1116R | Recombinant Rat CLNS1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLNS1A-3743H | Recombinant Human CLNS1A protein, GST-tagged | +Inquiry |
| CLNS1A-1509H | Recombinant Human CLNS1A Protein, GST-tagged | +Inquiry |
| CLNS1A-27276TH | Recombinant Human CLNS1A, His-tagged | +Inquiry |
| CLNS1A-1458R | Recombinant Rat CLNS1A Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLNS1A-7437HCL | Recombinant Human CLNS1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLNS1A Products
Required fields are marked with *
My Review for All CLNS1A Products
Required fields are marked with *
