Recombinant Human CLPTM1, His-tagged
Cat.No. : | CLPTM1-11345H |
Product Overview : | Recombinant Human CLPTM1(NP_001285)(1 - 351 aa), fused to His tag, was expressed in E. coli. |
Availability | September 05, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 - 351 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MAAAQEADGARSAVVAAGGGSSGQVTSNGSIGRDPPAETQPQNPPAQPAPNAWQVIKGVLFRIFIIWAISSWFRRGPAPQDQAGPGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIYFNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPWNFLGDELYEQSDEEQDSVKVALLE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | CLPTM1 cleft lip and palate associated transmembrane protein 1 [ Homo sapiens ] |
Official Symbol | CLPTM1 |
Synonyms | CLPTM1; cleft lip and palate associated transmembrane protein 1; cleft lip and palate transmembrane protein 1; |
Gene ID | 1209 |
mRNA Refseq | NM_001294.2 |
Protein Refseq | NP_001285 |
MIM | 604783 |
UniProt ID | O96005 |
◆ Recombinant Proteins | ||
CLPTM1-3601M | Recombinant Mouse CLPTM1 Protein | +Inquiry |
CLPTM1-1066Z | Recombinant Zebrafish CLPTM1 | +Inquiry |
RFL19968HF | Recombinant Full Length Human Cleft Lip And Palate Transmembrane Protein 1(Clptm1) Protein, His-Tagged | +Inquiry |
CLPTM1-1889HF | Recombinant Full Length Human CLPTM1 Protein, GST-tagged | +Inquiry |
CLPTM1-583H | Active Recombinant Human CLPTM1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLPTM1-7433HCL | Recombinant Human CLPTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLPTM1 Products
Required fields are marked with *
My Review for All CLPTM1 Products
Required fields are marked with *