"CLSTN1" Related Products

Expand
Expand
Expand

Recombinant Human CLSTN1 protein, T7/His-tagged

Cat.No.: CLSTN1-65H
Product Overview: Recombinant human CLSTN1 cDNA (29 - 859aa, Isoform_II, derived from BC033902) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFARVNKHKPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESF EVTVTKEGEICGFKIHGQNVPFDAVVVDKSTGEGVIRSKEKLDCELQKDYSFTIQAYDCGKGPDGTNVKKSHKAT VHIQVNDVNEYAPVFKEKSYKATVIEGKQYDSILRVEAVDADCSPQFSQICSYEIITPDVPFTVDKDGYIKNTEK LNYGKEHQYKLTVTAYDCGKKRATEDVLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVFPNIHLETCDEPVASV QATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMGLPTDNGHDSDQVFEFNGTQAVRIP DGVVSVSPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFLFRQDPSEEKKYRPAEFHWK LNQVCDEEWHHYVLNVEFPSVTLYVDGTSHEPFSVTEDYPLHPSKIETQLVVGACWQEFSGVENDNETEPVTVAS AGGDLHMTQFFRGNLAGLTLRSGKLADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAHPSQLVLTLEGEDLGELD KAMQHISYLNSRQFPTPGIRRLKITSTIKCFNEATCISVPPVDGYVMVLQPEEPKISLSGVHHFARAASEFESSE GVFLFPELRIISTITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIE VSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLDRKFKLICSELNGRYISNEFKVEVNVIHTANPMEHANH MAAQPQFVHPEHRSFVDLSGHNLANPHPFAVVPST
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro CLSTN1 mediated neuronal axonal transporting regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CLSTN1 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CLSTN1 calsyntenin 1 [ Homo sapiens ]
Official Symbol: CLSTN1
Synonyms: CLSTN1; calsyntenin 1; calsyntenin-1; cadherin related family member 12; CDHR12; CSTN1; KIAA0911; alcadein-alpha; alcadein alpha 1; non-classical cadherin XB31alpha; cadherin-related family member 12; non-classical cadherin XB31alpha1; alzheimer-related c
Gene ID: 22883
mRNA Refseq: NM_001009566
Protein Refseq: NP_001009566
MIM: 611321
UniProt ID: O94985
Chromosome Location: 1p36.22
Function: calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.