Recombinant Human CLTA Protein, GST-tagged
Cat.No. : | CLTA-1523H |
Product Overview : | Human CLTA full-length ORF ( AAH19287, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq, May 2010] |
Molecular Mass : | 49.61 kDa |
AA Sequence : | MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLTA clathrin, light chain A [ Homo sapiens ] |
Official Symbol | CLTA |
Synonyms | CLTA; clathrin, light chain A; clathrin, light polypeptide (Lca); clathrin light chain A; Lca; LCA; |
Gene ID | 1211 |
mRNA Refseq | NM_001076677 |
Protein Refseq | NP_001070145 |
MIM | 118960 |
UniProt ID | P09496 |
◆ Recombinant Proteins | ||
CLTA-1523H | Recombinant Human CLTA Protein, GST-tagged | +Inquiry |
Clta-2705M | Recombinant Mouse Clta protein, His-SUMO-tagged | +Inquiry |
CLTA-12280Z | Recombinant Zebrafish CLTA | +Inquiry |
Clta-8169M | Recombinant Mouse Clta protein, His & T7-tagged | +Inquiry |
CLTA-1127R | Recombinant Rat CLTA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLTA-7429HCL | Recombinant Human CLTA 293 Cell Lysate | +Inquiry |
CLTA-7428HCL | Recombinant Human CLTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLTA Products
Required fields are marked with *
My Review for All CLTA Products
Required fields are marked with *