Recombinant Human CLTCL1 Protein (1423-1566 aa), His-tagged
| Cat.No. : | CLTCL1-411H |
| Product Overview : | Recombinant Human CLTCL1 Protein (1423-1566 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1423-1566 aa |
| Description : | Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma mbrane or to the trans-Golgi network. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 20.8 kDa |
| AA Sequence : | LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | CLTCL1 clathrin, heavy chain-like 1 [ Homo sapiens ] |
| Official Symbol | CLTCL1 |
| Synonyms | CLTD; CHC22; CLH22; CLTCL |
| Gene ID | 8218 |
| mRNA Refseq | NM_007098.3 |
| Protein Refseq | NP_009029.3 |
| MIM | 601273 |
| UniProt ID | P53675 |
| ◆ Recombinant Proteins | ||
| CLTCL1-411H | Recombinant Human CLTCL1 Protein (1423-1566 aa), His-tagged | +Inquiry |
| CLTCL1-2067H | Recombinant Human CLTCL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CLTCL1-620H | Recombinant Human CLTCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLTCL1-1363H | Recombinant Human CLTCL1 Protein (1423-1566 aa), His-tagged | +Inquiry |
| CLTCL1-3250H | Recombinant Human CLTCL1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLTCL1 Products
Required fields are marked with *
My Review for All CLTCL1 Products
Required fields are marked with *
