Recombinant Human CLUAP1 Protein, GST-tagged

• Cat.No.: CLUAP1-1527H
• Product Overview: Human CLUAP1 full-length ORF ( NP_079069.1, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene contains a single coiled-coil region. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jul 2012]
• Molecular Mass: 55.5 kDa
• AA Sequence: MRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRMEQERFEEAKNTLCLIQNKLKEEEKRLLKSGSNDDSDIDIQEDDESDSELEERRLPKPQTAMEMLMQGRPGKRIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRVRKSEPLDESDNDF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLUAP1 clusterin associated protein 1 [ Homo sapiens ]
• Official Symbol: CLUAP1
• Synonyms: CLUAP1; clusterin associated protein 1; clusterin-associated protein 1; FAP22; flagellar associated protein 22; qilin like protein; homolog (Chlamydomonas); FLJ13297; KIAA0643; flagellar associated protein 22, qilin-like protein, homolog
• Gene ID: 23059
• mRNA Refseq: NM_015041
• Protein Refseq: NP_055856
• MIM: 616787
• UniProt ID: Q96AJ1