Recombinant Human CLUL1, His-tagged
| Cat.No. : | CLUL1-70H |
| Product Overview : | Recombinant Human Clusterin-Like Protein 1/CLUL1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala21-Ala442) of Human CLUL1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 21-442 a.a. |
| Description : | Clusterin-Like Protein 1 (CLUL1) is a secreted protein that belongs to the clusterin family. CLUL1 is synthesized as a 466 amino acid precursor that contains a 20 amino acid signal sequence, and a 446 amino acid mature chain. CLUL1 is expressed predominantly by cone photoreceptors of the retina. It has been shown that CLUL1 expression is down-regulated in some forms of retinal disease. |
| AA Sequence : | APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQ EALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNCMRIYTTCQPSWSSVKNKIERFFRKIY QFLFPFHEDNEKDLPISEKLIEEDAQLTQMEDVFSQLTVDVNSLFNRSFNVFRQMQQEFDQTFQS HFISDTDLTEPYFFPAFSKEPMTKADLEQCWDIPNFFQLFCNFSVSIYESVSETITKMLKAIEDL PKQDKAPDHGGLISKMLPGQDRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDCPDVPALHTELDE AIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIIFNSIQVVPRIHE GNISKQDETMMTDLSILPSSNFTLKIPLEESAVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | CLUL1 clusterin-like 1 (retinal) [ Homo sapiens ] |
| Official Symbol | CLUL1 |
| Synonyms | CLUL1; clusterin-like 1 (retinal); clusterin-like protein 1; retinal-specific clusterin-like protein; RA337M; |
| Gene ID | 27098 |
| mRNA Refseq | NM_014410 |
| Protein Refseq | NP_055225 |
| UniProt ID | Q15846 |
| Chromosome Location | 18p11.32 |
| ◆ Recombinant Proteins | ||
| CLUL1-70H | Recombinant Human CLUL1, His-tagged | +Inquiry |
| CLUL1-301401H | Recombinant Human CLUL1 protein, GST-tagged | +Inquiry |
| CLUL1-5803Z | Recombinant Zebrafish CLUL1 | +Inquiry |
| CLUL1-1474R | Recombinant Rat CLUL1 Protein | +Inquiry |
| CLUL1-1896HF | Recombinant Full Length Human CLUL1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLUL1-370HCL | Recombinant Human CLUL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLUL1 Products
Required fields are marked with *
My Review for All CLUL1 Products
Required fields are marked with *
