Recombinant Human CLUL1 protein, GST-tagged

• Cat.No.: CLUL1-301401H
• Product Overview: Recombinant Human CLUL1 (21-124 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ala21-Cys124
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNC
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CLUL1 clusterin-like 1 (retinal) [ Homo sapiens ]
• Official Symbol: CLUL1
• Synonyms: CLUL1; clusterin-like 1 (retinal); clusterin-like protein 1; retinal-specific clusterin-like protein; RA337M
• Gene ID: 27098
• mRNA Refseq: NM_014410
• Protein Refseq: NP_055225
• UniProt ID: Q15846