Recombinant Human CLUL1 protein, His-tagged
Cat.No. : | CLUL1-2822H |
Product Overview : | Recombinant Human CLUL1 protein(21 - 124 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21 - 124 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CLUL1 clusterin-like 1 (retinal) [ Homo sapiens ] |
Official Symbol | CLUL1 |
Synonyms | CLUL1; clusterin-like 1 (retinal); clusterin-like protein 1; retinal-specific clusterin-like protein; RA337M; |
Gene ID | 27098 |
mRNA Refseq | NM_014410 |
Protein Refseq | NP_055225 |
UniProt ID | Q15846 |
◆ Recombinant Proteins | ||
CLUL1-1132R | Recombinant Rat CLUL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLUL1-2822H | Recombinant Human CLUL1 protein, His-tagged | +Inquiry |
CLUL1-1474R | Recombinant Rat CLUL1 Protein | +Inquiry |
CLUL1-1528H | Recombinant Human CLUL1 Protein, GST-tagged | +Inquiry |
CLUL1-301401H | Recombinant Human CLUL1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLUL1-370HCL | Recombinant Human CLUL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLUL1 Products
Required fields are marked with *
My Review for All CLUL1 Products
Required fields are marked with *