Recombinant Human CLVS2 protein, GST-tagged
Cat.No. : | CLVS2-100H |
Product Overview : | Recombinant Human CLVS2 protein(NP_001010852.2)(265-327 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 265-327 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | CLVS2 clavesin 2 [ Homo sapiens (human) ] |
Official Symbol | CLVS2 |
Synonyms | RLBP1L2; C6orf212; C6orf213; bA160A10.4 |
Gene ID | 134829 |
mRNA Refseq | NM_001010852.4 |
Protein Refseq | NP_001010852.2 |
MIM | 616945 |
UniProt ID | Q5SYC1 |
◆ Recombinant Proteins | ||
CLVS2-100H | Recombinant Human CLVS2 protein, GST-tagged | +Inquiry |
CLVS2-5633H | Recombinant Human CLVS2 protein, GST-tagged | +Inquiry |
CLVS2-923R | Recombinant Rhesus monkey CLVS2 Protein, His-tagged | +Inquiry |
CLVS2-748R | Recombinant Rhesus Macaque CLVS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLVS2-3158Z | Recombinant Zebrafish CLVS2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLVS2-7424HCL | Recombinant Human CLVS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLVS2 Products
Required fields are marked with *
My Review for All CLVS2 Products
Required fields are marked with *