Recombinant Human CMA1 Protein, GST-tagged

Cat.No. : CMA1-1530H
Product Overview : Human CMA1 full-length ORF (NP_001827.1, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants. [provided by RefSeq, Apr 2015]
Molecular Mass : 53.57 kDa
AA Sequence : MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CMA1 chymase 1, mast cell [ Homo sapiens ]
Official Symbol CMA1
Synonyms CMA1; chymase 1, mast cell; chymase; alpha-chymase; chymase, heart; chymase, mast cell; mast cell protease I; chymase 1 preproprotein transcript E; chymase 1 preproprotein transcript I; CYH; MCT1; MGC119890; MGC119891;
Gene ID 1215
mRNA Refseq NM_001836
Protein Refseq NP_001827
MIM 118938
UniProt ID P23946

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CMA1 Products

Required fields are marked with *

My Review for All CMA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon