Recombinant Human CMC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CMC1-5776H
• Product Overview: CMC1 MS Standard C13 and N15-labeled recombinant protein (NP_872329) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CMC1 (C-X9-C Motif Containing 1) is a Protein Coding gene.
• Molecular Mass: 12.5 kDa
• AA Sequence: MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CMC1 C-X9-C motif containing 1 [ Homo sapiens (human) ]
• Official Symbol: CMC1
• Synonyms: CMC1; C-X9-C motif containing 1; C3orf68; COX assembly mitochondrial protein homolog; C-x(9)-C motif containing 1; COX assembly mitochondrial protein 1 homolog; CX9C mitochondrial protein required for full expression of COX 1; cmc1p; mitochondrial metallochaperone-like protein
• Gene ID: 152100
• mRNA Refseq: NM_182523
• Protein Refseq: NP_872329
• MIM: 615166
• UniProt ID: Q7Z7K0