Recombinant Human CMC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CMC1-5776H |
| Product Overview : | CMC1 MS Standard C13 and N15-labeled recombinant protein (NP_872329) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | CMC1 (C-X9-C Motif Containing 1) is a Protein Coding gene. |
| Molecular Mass : | 12.5 kDa |
| AA Sequence : | MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CMC1 C-X9-C motif containing 1 [ Homo sapiens (human) ] |
| Official Symbol | CMC1 |
| Synonyms | CMC1; C-X9-C motif containing 1; C3orf68; COX assembly mitochondrial protein homolog; C-x(9)-C motif containing 1; COX assembly mitochondrial protein 1 homolog; CX9C mitochondrial protein required for full expression of COX 1; cmc1p; mitochondrial metallochaperone-like protein |
| Gene ID | 152100 |
| mRNA Refseq | NM_182523 |
| Protein Refseq | NP_872329 |
| MIM | 615166 |
| UniProt ID | Q7Z7K0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMC1 Products
Required fields are marked with *
My Review for All CMC1 Products
Required fields are marked with *
