Recombinant Human CMC4 protein, GST-tagged
| Cat.No. : | CMC4-294H |
| Product Overview : | Recombinant Human CMC4 protein(6-68 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 6-68 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | PCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CMC4 C-x(9)-C motif containing 4 homolog (S. cerevisiae) [ Homo sapiens (human) ] |
| Official Symbol | CMC4 |
| Synonyms | CMC4; p8; C6.1B; MTCP1; MTCP1B; MTCP1NB; p8MTCP1; C-x(9)-C motif containing 4 homolog (S. cerevisiae); cx9C motif-containing protein 4; MTCP-1 type A; protein p8 MTCP-1; mature T-cell proliferation-1 type A; mature T-cell proliferation 1, isoform p8; mature T-cell proliferation 1 neighbor protein |
| Gene ID | 100272147 |
| mRNA Refseq | NM_001018024 |
| Protein Refseq | NP_001018024 |
| UniProt ID | P56277 |
| ◆ Recombinant Proteins | ||
| CMC4-294H | Recombinant Human CMC4 protein, GST-tagged | +Inquiry |
| CMC4-2695H | Recombinant Human CMC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CMC4-1075H | Recombinant Human CMC4, GST-tagged | +Inquiry |
| CMC4-4575H | Recombinant Human CMC4 protein, GST-tagged | +Inquiry |
| CMC4-1638H | Recombinant Human CMC4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMC4 Products
Required fields are marked with *
My Review for All CMC4 Products
Required fields are marked with *
