Recombinant Human CMTM8 Protein, GST-tagged

• Cat.No.: CMTM8-1547H
• Product Overview: Human CMTM8 full-length ORF ( AAH41390, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor, and plays a role in regulating the migration of tumor cells. The encoded protein is thought to function as a a negative regulator of epidermal growth factor-induced signaling. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016]
• Molecular Mass: 44.77 kDa
• AA Sequence: MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLHGFLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMFVAVSYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CMTM8 CKLF-like MARVEL transmembrane domain containing 8 [ Homo sapiens ]
• Official Symbol: CMTM8
• Synonyms: CMTM8; CKLF-like MARVEL transmembrane domain containing 8; chemokine like factor super family 8 , chemokine like factor superfamily 8 , CKLFSF8; CKLF-like MARVEL transmembrane domain-containing protein 8; chemokine-like factor superfamily 8; chemokine-like factor super family 8; chemokine-like factor superfamily member 8; CKLFSF8; CKLFSF8-V2
• Gene ID: 152189
• mRNA Refseq: NM_178868
• Protein Refseq: NP_849199
• MIM: 607891
• UniProt ID: Q8IZV2