Recombinant Human CMTM8 Protein, GST-tagged

Cat.No. : CMTM8-1547H
Product Overview : Human CMTM8 full-length ORF ( AAH41390, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor, and plays a role in regulating the migration of tumor cells. The encoded protein is thought to function as a a negative regulator of epidermal growth factor-induced signaling. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016]
Molecular Mass : 44.77 kDa
AA Sequence : MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLHGFLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMFVAVSYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CMTM8 CKLF-like MARVEL transmembrane domain containing 8 [ Homo sapiens ]
Official Symbol CMTM8
Synonyms CMTM8; CKLF-like MARVEL transmembrane domain containing 8; chemokine like factor super family 8 , chemokine like factor superfamily 8 , CKLFSF8; CKLF-like MARVEL transmembrane domain-containing protein 8; chemokine-like factor superfamily 8; chemokine-like factor super family 8; chemokine-like factor superfamily member 8; CKLFSF8; CKLFSF8-V2;
Gene ID 152189
mRNA Refseq NM_178868
Protein Refseq NP_849199
MIM 607891
UniProt ID Q8IZV2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CMTM8 Products

Required fields are marked with *

My Review for All CMTM8 Products

Required fields are marked with *

0
cart-icon