Recombinant Human CMTM8 Protein, GST-tagged
Cat.No. : | CMTM8-1547H |
Product Overview : | Human CMTM8 full-length ORF ( AAH41390, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor, and plays a role in regulating the migration of tumor cells. The encoded protein is thought to function as a a negative regulator of epidermal growth factor-induced signaling. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 44.77 kDa |
AA Sequence : | MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLHGFLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMFVAVSYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CMTM8 CKLF-like MARVEL transmembrane domain containing 8 [ Homo sapiens ] |
Official Symbol | CMTM8 |
Synonyms | CMTM8; CKLF-like MARVEL transmembrane domain containing 8; chemokine like factor super family 8 , chemokine like factor superfamily 8 , CKLFSF8; CKLF-like MARVEL transmembrane domain-containing protein 8; chemokine-like factor superfamily 8; chemokine-like factor super family 8; chemokine-like factor superfamily member 8; CKLFSF8; CKLFSF8-V2; |
Gene ID | 152189 |
mRNA Refseq | NM_178868 |
Protein Refseq | NP_849199 |
MIM | 607891 |
UniProt ID | Q8IZV2 |
◆ Cell & Tissue Lysates | ||
CMTM8-190HCL | Recombinant Human CMTM8 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMTM8 Products
Required fields are marked with *
My Review for All CMTM8 Products
Required fields are marked with *