Recombinant Human CNDP1 Protein, GST-tagged

Cat.No. : CNDP1-1552H
Product Overview : Human CNDP1 full-length ORF ( NP_116038.4, 1 a.a. - 507 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region. [provided by RefSeq, Jul 2008]
Molecular Mass : 83.1 kDa
AA Sequence : MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNDP1 carnosine dipeptidase 1 (metallopeptidase M20 family) [ Homo sapiens ]
Official Symbol CNDP1
Synonyms CNDP1; carnosine dipeptidase 1 (metallopeptidase M20 family); beta-Ala-His dipeptidase; carnosinase 1; CN1; CPGL2; glutamate carboxypeptidase like protein 2; HsT2308; MGC10825; serum carnosinase; CNDP dipeptidase 1; glutamate carboxypeptidase-like protein 2; MGC102737; MGC142072;
Gene ID 84735
mRNA Refseq NM_032649
Protein Refseq NP_116038
MIM 609064
UniProt ID Q96KN2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNDP1 Products

Required fields are marked with *

My Review for All CNDP1 Products

Required fields are marked with *

0
cart-icon