Recombinant Human CNDP1 Protein, GST-tagged
| Cat.No. : | CNDP1-1552H |
| Product Overview : | Human CNDP1 full-length ORF ( NP_116038.4, 1 a.a. - 507 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 83.1 kDa |
| AA Sequence : | MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CNDP1 carnosine dipeptidase 1 (metallopeptidase M20 family) [ Homo sapiens ] |
| Official Symbol | CNDP1 |
| Synonyms | CNDP1; carnosine dipeptidase 1 (metallopeptidase M20 family); beta-Ala-His dipeptidase; carnosinase 1; CN1; CPGL2; glutamate carboxypeptidase like protein 2; HsT2308; MGC10825; serum carnosinase; CNDP dipeptidase 1; glutamate carboxypeptidase-like protein 2; MGC102737; MGC142072; |
| Gene ID | 84735 |
| mRNA Refseq | NM_032649 |
| Protein Refseq | NP_116038 |
| MIM | 609064 |
| UniProt ID | Q96KN2 |
| ◆ Recombinant Proteins | ||
| CNDP1-1552H | Recombinant Human CNDP1 Protein, GST-tagged | +Inquiry |
| CNDP1-1913HF | Recombinant Full Length Human CNDP1 Protein, GST-tagged | +Inquiry |
| CNDP1-11373H | Recombinant Human CNDP1, His-tagged | +Inquiry |
| CNDP1-2241H | Recombinant Human CNDP1 Protein (Pro28-His507), C-His tagged | +Inquiry |
| CNDP1-382H | Recombinant Human CNDP1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNDP1-1580MCL | Recombinant Mouse CNDP1 cell lysate | +Inquiry |
| CNDP1-3037HCL | Recombinant Human CNDP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNDP1 Products
Required fields are marked with *
My Review for All CNDP1 Products
Required fields are marked with *
