Recombinant Human CNEP1R1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CNEP1R1-2703H
• Product Overview: TMEM188 MS Standard C13 and N15-labeled recombinant protein (NP_694993) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a transmembrane protein that belongs to the Tmemb_18A family. A similar protein in yeast is a component of an endoplasmic reticulum-associated protein phosphatase complex and is thought to play a role in the synthesis of triacylglycerol. Alternate splicing results in multiple transcript variants.
• Molecular Mass: 16 kDa
• AA Sequence: MNSLEQAEAPRVVSLIPAVVSGNCQDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CNEP1R1 CTD nuclear envelope phosphatase 1 regulatory subunit 1 [ Homo sapiens (human) ]
• Official Symbol: CNEP1R1
• Synonyms: CNEP1R1; CTD nuclear envelope phosphatase 1 regulatory subunit 1; NEP1R1; TMP125; NEP1-R1; TMEM188; C16orf69; nuclear envelope phosphatase-regulatory subunit 1; nuclear envelope phosphatase 1-regulatory subunit 1; transmembrane protein 188
• Gene ID: 255919
• mRNA Refseq: NM_153261
• Protein Refseq: NP_694993
• MIM: 616869
• UniProt ID: Q8N9A8