Recombinant Human CNIH4 Protein, GST-tagged
Cat.No. : | CNIH4-5267H |
Product Overview : | Human HSPC163 full-length ORF ( AAH00573, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CNIH4 (Cornichon Family AMPA Receptor Auxiliary Protein 4) is a Protein Coding gene. GO annotations related to this gene include CCR5 chemokine receptor binding. An important paralog of this gene is CNIH1. |
Molecular Mass : | 41.03 kDa |
AA Sequence : | MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNIH4 cornichon homolog 4 (Drosophila) [ Homo sapiens ] |
Official Symbol | CNIH4 |
Synonyms | CNIH4; cornichon homolog 4 (Drosophila); protein cornichon homolog 4; HSPC163; |
Gene ID | 29097 |
mRNA Refseq | NM_014184 |
Protein Refseq | NP_054903 |
UniProt ID | Q9P003 |
◆ Recombinant Proteins | ||
CNIH4-1804M | Recombinant Mouse CNIH4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33803PF | Recombinant Full Length Pongo Abelii Protein Cornichon Homolog 4(Cnih4) Protein, His-Tagged | +Inquiry |
CNIH4-760R | Recombinant Rhesus Macaque CNIH4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNIH4-5656HF | Recombinant Full Length Human CNIH4 Protein, GST-tagged | +Inquiry |
CNIH4-3653M | Recombinant Mouse CNIH4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNIH4-7407HCL | Recombinant Human CNIH4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNIH4 Products
Required fields are marked with *
My Review for All CNIH4 Products
Required fields are marked with *