Recombinant Human CNKSR2 Protein (650-800 aa), His-tagged
Cat.No. : | CNKSR2-1365H |
Product Overview : | Recombinant Human CNKSR2 Protein (650-800 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 650-800 aa |
Description : | May function as an adapter protein or regulator of Ras signaling pathways. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.1 kDa |
AA Sequence : | AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | CNKSR2 connector enhancer of kinase suppressor of Ras 2 [ Homo sapiens ] |
Official Symbol | CNKSR2 |
Synonyms | CNKSR2; CNK2; KIAA0902; KSR2; MAGUIN; |
Gene ID | 22866 |
mRNA Refseq | NM_001168647 |
Protein Refseq | NP_001162118 |
MIM | 300724 |
UniProt ID | Q8WXI2 |
◆ Recombinant Proteins | ||
CNKSR2-1365H | Recombinant Human CNKSR2 Protein (650-800 aa), His-tagged | +Inquiry |
CNKSR2-1146R | Recombinant Rat CNKSR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNKSR2-1488R | Recombinant Rat CNKSR2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNKSR2 Products
Required fields are marked with *
My Review for All CNKSR2 Products
Required fields are marked with *
0
Inquiry Basket