Recombinant Human CNKSR2 Protein (650-800 aa), His-tagged

Cat.No. : CNKSR2-1365H
Product Overview : Recombinant Human CNKSR2 Protein (650-800 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 650-800 aa
Description : May function as an adapter protein or regulator of Ras signaling pathways.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 19.1 kDa
AA Sequence : AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name CNKSR2 connector enhancer of kinase suppressor of Ras 2 [ Homo sapiens ]
Official Symbol CNKSR2
Synonyms CNKSR2; CNK2; KIAA0902; KSR2; MAGUIN;
Gene ID 22866
mRNA Refseq NM_001168647
Protein Refseq NP_001162118
MIM 300724
UniProt ID Q8WXI2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNKSR2 Products

Required fields are marked with *

My Review for All CNKSR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon