Recombinant Human CNN3 Protein, GST-tagged
Cat.No. : | CNN3-1569H |
Product Overview : | Human CNN3 full-length ORF ( NP_001830.1, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 62.8 kDa |
AA Sequence : | MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNN3 calponin 3, acidic [ Homo sapiens ] |
Official Symbol | CNN3 |
Synonyms | CNN3; calponin 3, acidic; calponin-3; calponin, acidic isoform; dJ639P13.2.2 (acidic calponin 3); |
Gene ID | 1266 |
mRNA Refseq | NM_001839 |
Protein Refseq | NP_001830 |
MIM | 602374 |
UniProt ID | Q15417 |
◆ Recombinant Proteins | ||
CNN3-1149R | Recombinant Rat CNN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cnn3-2219M | Recombinant Mouse Cnn3 Protein, Myc/DDK-tagged | +Inquiry |
CNN3-416H | Recombinant Human CNN3 Protein (2-329 aa), His-tagged | +Inquiry |
CNN3-26293TH | Recombinant Human CNN3 | +Inquiry |
CNN3-680HFL | Recombinant Full Length Human CNN3 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN3-7404HCL | Recombinant Human CNN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN3 Products
Required fields are marked with *
My Review for All CNN3 Products
Required fields are marked with *