Recombinant Human CNN3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CNN3-2421H |
Product Overview : | CNN3 MS Standard C13 and N15-labeled recombinant protein (NP_001830) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. |
Molecular Mass : | 36.4 kDa |
AA Sequence : | MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CNN3 calponin 3 [ Homo sapiens (human) ] |
Official Symbol | CNN3 |
Synonyms | CNN3; calponin 3, acidic; calponin-3; calponin, acidic isoform; dJ639P13.2.2 (acidic calponin 3); |
Gene ID | 1266 |
mRNA Refseq | NM_001839 |
Protein Refseq | NP_001830 |
MIM | 602374 |
UniProt ID | Q15417 |
◆ Recombinant Proteins | ||
CNN3-416H | Recombinant Human CNN3 Protein (2-329 aa), His-tagged | +Inquiry |
CNN3-26293TH | Recombinant Human CNN3 | +Inquiry |
CNN3-1569H | Recombinant Human CNN3 Protein, GST-tagged | +Inquiry |
Cnn3-2219M | Recombinant Mouse Cnn3 Protein, Myc/DDK-tagged | +Inquiry |
CNN3-2421H | Recombinant Human CNN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN3-7404HCL | Recombinant Human CNN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNN3 Products
Required fields are marked with *
My Review for All CNN3 Products
Required fields are marked with *
0
Inquiry Basket