Recombinant Human CNR2 Full Length Transmembrane protein, His-tagged
| Cat.No. : | CNR2-29H |
| Product Overview : | Recombinant Human CNR2 protein(P34972)(1-360aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-360aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.5 kDa |
| AA Sequence : | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CNR2 cannabinoid receptor 2 (macrophage) [ Homo sapiens ] |
| Official Symbol | CNR2 |
| Synonyms | CNR2; cannabinoid receptor 2 (macrophage); cannabinoid receptor 2; CB2; testis-dominant CNR2 isoform CB2; CX5; CB-2; |
| Gene ID | 1269 |
| mRNA Refseq | NM_001841 |
| Protein Refseq | NP_001832 |
| MIM | 605051 |
| UniProt ID | P34972 |
| ◆ Recombinant Proteins | ||
| RFL25273ZF | Recombinant Full Length Zea Mays Cell Number Regulator 2(Cnr2) Protein, His-Tagged | +Inquiry |
| CNR2-738H | Recombinant Human CNR2 protein(Met1-Cys360) | +Inquiry |
| CNR2-14HFL | Recombinant Full Length Human CNR2 Proteoliposome | +Inquiry |
| RFL26956HF | Recombinant Full Length Human Cannabinoid Receptor 2(Cnr2) Protein, His-Tagged | +Inquiry |
| CNR2-26236TH | Recombinant Human CNR2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNR2-7394HCL | Recombinant Human CNR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNR2 Products
Required fields are marked with *
My Review for All CNR2 Products
Required fields are marked with *
