Recombinant Full Length Human CNR2 Proteoliposome
Cat.No. : | CNR2-14HFL |
Product Overview : | Human CNR2 full-length ORF (NP_001832.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Description : | The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors. |
Form : | Liquid |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC |
Applications : | Antibody Production |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Preparation : | in vitro wheat germ expression system with proprietary liposome technology |
Gene Name | CNR2 cannabinoid receptor 2 [ Homo sapiens (human) ] |
Official Symbol | CNR2 |
Synonyms | CB2; CX5; CB-2 |
Gene ID | 1269 |
mRNA Refseq | NM_001841.3 |
Protein Refseq | NP_001832.1 |
MIM | 605051 |
UniProt ID | P34972 |
◆ Recombinant Proteins | ||
CNR2-1154HFL | Recombinant Human CNR2 protein, His&Flag-tagged | +Inquiry |
RFL25273ZF | Recombinant Full Length Zea Mays Cell Number Regulator 2(Cnr2) Protein, His-Tagged | +Inquiry |
CNR2-26236TH | Recombinant Human CNR2 | +Inquiry |
CNR2-1823M | Recombinant Mouse CNR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNR2-102HF | Recombinant Full Length Human CNR2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNR2-7394HCL | Recombinant Human CNR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNR2 Products
Required fields are marked with *
My Review for All CNR2 Products
Required fields are marked with *
0
Inquiry Basket