Recombinant Human CNRIP1 Protein, GST-tagged
Cat.No. : | CNRIP1-1602H |
Product Overview : | Human CNRIP1 full-length ORF (BAG34727.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that interacts with the C-terminal tail of cannabinoid receptor 1. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2013] |
Molecular Mass : | 44.44 kDa |
AA Sequence : | MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNRIP1 cannabinoid receptor interacting protein 1 [ Homo sapiens ] |
Official Symbol | CNRIP1 |
Synonyms | CNRIP1; cannabinoid receptor interacting protein 1; C2orf32, chromosome 2 open reading frame 32; CB1 cannabinoid receptor-interacting protein 1; CRIP1; CRIP1a; CRIP1b; DKFZP566K1924; CRIP-1; cannabinoid receptor CB1-interacting protein 1; C2orf32; DKFZp566K1924; |
Gene ID | 25927 |
mRNA Refseq | NM_015463 |
Protein Refseq | NP_056278 |
UniProt ID | Q96F85 |
◆ Recombinant Proteins | ||
CNRIP1-11408H | Recombinant Human CNRIP1, His-tagged | +Inquiry |
CNRIP1-1837H | Recombinant Human CNRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CNRIP1-7146H | Recombinant Human Cannabinoid Receptor Interacting Protein 1, His-tagged | +Inquiry |
CNRIP1-4919C | Recombinant Chicken CNRIP1 | +Inquiry |
CNRIP1-1499R | Recombinant Rat CNRIP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNRIP1-7393HCL | Recombinant Human CNRIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNRIP1 Products
Required fields are marked with *
My Review for All CNRIP1 Products
Required fields are marked with *