Recombinant Human CNTN2 protein(611-810 aa), N-SUMO & C-His-tagged

• Cat.No.: CNTN2-2819H
• Product Overview: Recombinant Human CNTN2 protein(Q02246)(611-810 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 611-810 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: PGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGGGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTARVPGADAQYFVYSNESVRPYTPFEVKIRSYNRRGDGPESLTALVYSAEE

Gene Information

• Gene Name: CNTN2 contactin 2 (axonal) [ Homo sapiens ]
• Official Symbol: CNTN2
• Synonyms: CNTN2; contactin 2 (axonal); AXT, TAX; contactin-2; TAG 1; TAX1; TAX-1; axonal glycoprotein TAG-1; axonin-1 cell adhesion molecule; transient axonal glycoprotein 1; contactin 2 (transiently expressed); transiently-expressed axonal glycoprotein; AXT; TAX; TAG-1; FLJ37193; FLJ42746; MGC157722; DKFZp781D102
• Gene ID: 6900
• mRNA Refseq: NM_005076
• Protein Refseq: NP_005067
• MIM: 190197
• UniProt ID: Q02246