Recombinant Human CNTN2 protein(611-810 aa), N-SUMO & C-His-tagged
Cat.No. : | CNTN2-2819H |
Product Overview : | Recombinant Human CNTN2 protein(Q02246)(611-810 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 611-810 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGGGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTARVPGADAQYFVYSNESVRPYTPFEVKIRSYNRRGDGPESLTALVYSAEE |
Gene Name | CNTN2 contactin 2 (axonal) [ Homo sapiens ] |
Official Symbol | CNTN2 |
Synonyms | CNTN2; contactin 2 (axonal); AXT, TAX; contactin-2; TAG 1; TAX1; TAX-1; axonal glycoprotein TAG-1; axonin-1 cell adhesion molecule; transient axonal glycoprotein 1; contactin 2 (transiently expressed); transiently-expressed axonal glycoprotein; AXT; TAX; TAG-1; FLJ37193; FLJ42746; MGC157722; DKFZp781D102; |
Gene ID | 6900 |
mRNA Refseq | NM_005076 |
Protein Refseq | NP_005067 |
MIM | 190197 |
UniProt ID | Q02246 |
◆ Recombinant Proteins | ||
CNTN2-1608H | Recombinant Human CNTN2 Protein, GST-tagged | +Inquiry |
CNTN2-776R | Recombinant Rhesus Macaque CNTN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cntn2-33M | Recombinant Mouse Cntn2 Protein, Gln31-Ser1014, C-6×His tagged | +Inquiry |
Cntn2-7425M | Recombinant Mouse Cntn2 protein(Gln31-Glu1013), His-tagged | +Inquiry |
CNTN2-1161R | Recombinant Rat CNTN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTN2-1518MCL | Recombinant Mouse CNTN2 cell lysate | +Inquiry |
CNTN2-3035HCL | Recombinant Human CNTN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTN2 Products
Required fields are marked with *
My Review for All CNTN2 Products
Required fields are marked with *
0
Inquiry Basket