Recombinant Human CNTNAP3 protein, GST-tagged
Cat.No. : | CNTNAP3-3699H |
Product Overview : | Recombinant Human CNTNAP3 protein(625-695 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 625-695 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | TDAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYAAGAGQLRSAVNLAERCEQRLALRCGTARRPDSRDGT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CNTNAP3 contactin associated protein-like 3 [ Homo sapiens ] |
Official Symbol | CNTNAP3 |
Synonyms | CNTNAP3; contactin associated protein-like 3; contactin-associated protein-like 3; CASPR3; cell recognition molecule CASPR3 (FLJ14195; KIAA1714); CNTNAP3A; FLJ14195; KIAA1714; cell recognition molecule Caspr3; RP11-290L7.1; RP11-138L21.1; |
Gene ID | 79937 |
mRNA Refseq | NM_033655 |
Protein Refseq | NP_387504 |
MIM | 610517 |
UniProt ID | Q9BZ76 |
◆ Recombinant Proteins | ||
CNTNAP3-3935H | Recombinant Human CNTNAP3 protein, His-tagged | +Inquiry |
CNTNAP3-3699H | Recombinant Human CNTNAP3 protein, GST-tagged | +Inquiry |
CNTNAP3-809H | Recombinant Human CNTNAP3 Protein, His&GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTNAP3 Products
Required fields are marked with *
My Review for All CNTNAP3 Products
Required fields are marked with *