Recombinant Human CNTNAP4 Protein, GST-tagged
Cat.No. : | CNTNAP4-1612H |
Product Overview : | Human CNTNAP4 partial ORF ( NP_207837, 1145 a.a. - 1244 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the neurexin protein family. Members of this family function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains. This protein may also play a role in proper neurotransmission in the dopaminergic and GABAergic systems and mutations in this gene may be associated with certain psychiatric illnesses. A polymorphism in an intron of this gene may be associated with longevity. [provided by RefSeq, Apr 2016] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VLGRILEHSDVDQETALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNTNAP4 contactin associated protein-like 4 [ Homo sapiens ] |
Official Symbol | CNTNAP4 |
Synonyms | CNTNAP4; contactin associated protein-like 4; contactin-associated protein-like 4; CASPR4; KIAA1763; cell recognition protein CASPR4; cell recognition molecule Caspr4; |
Gene ID | 85445 |
mRNA Refseq | NM_033401 |
Protein Refseq | NP_207837 |
MIM | 610518 |
UniProt ID | Q9C0A0 |
◆ Recombinant Proteins | ||
Cntnap4-5825M | Recombinant Mouse Cntnap4 protein, His & T7-tagged | +Inquiry |
CNTNAP4-1832M | Recombinant Mouse CNTNAP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNTNAP4-5824H | Recombinant Human CNTNAP4 protein, His & T7-tagged | +Inquiry |
CNTNAP4-2254H | Recombinant Human CNTNAP4 Protein (Asn706-Lys886), N-His tagged | +Inquiry |
CNTNAP4-3694M | Recombinant Mouse CNTNAP4 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTNAP4 Products
Required fields are marked with *
My Review for All CNTNAP4 Products
Required fields are marked with *