Recombinant Human CNTNAP4 Protein, GST-tagged

Cat.No. : CNTNAP4-1612H
Product Overview : Human CNTNAP4 partial ORF ( NP_207837, 1145 a.a. - 1244 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the neurexin protein family. Members of this family function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains. This protein may also play a role in proper neurotransmission in the dopaminergic and GABAergic systems and mutations in this gene may be associated with certain psychiatric illnesses. A polymorphism in an intron of this gene may be associated with longevity. [provided by RefSeq, Apr 2016]
Molecular Mass : 36.74 kDa
AA Sequence : VLGRILEHSDVDQETALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNTNAP4 contactin associated protein-like 4 [ Homo sapiens ]
Official Symbol CNTNAP4
Synonyms CNTNAP4; contactin associated protein-like 4; contactin-associated protein-like 4; CASPR4; KIAA1763; cell recognition protein CASPR4; cell recognition molecule Caspr4;
Gene ID 85445
mRNA Refseq NM_033401
Protein Refseq NP_207837
MIM 610518
UniProt ID Q9C0A0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNTNAP4 Products

Required fields are marked with *

My Review for All CNTNAP4 Products

Required fields are marked with *

0
cart-icon
0
compare icon