Recombinant Human COG7 protein, GST-tagged
Cat.No. : | COG7-160H |
Product Overview : | Recombinant Human COG7 protein(NP_705831)(419-770 aa), fused with GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 419-770 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | CGLLSALKSLFAKYVSDFTSTLQSIRKKCKLDHIPPNSLFQEDWTAFQNSIRIIATCGELLRHCGDFEQQLANRILSTAGKYLSDSCSPRSLAGFQESILTDKKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLPLNLEPFVTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLATDIDYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSVNY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | COG7 component of oligomeric golgi complex 7 [ Homo sapiens ] |
Official Symbol | COG7 |
Synonyms | COG7; component of oligomeric golgi complex 7; conserved oligomeric Golgi complex subunit 7; COG complex subunit 7; CDG2E; |
Gene ID | 91949 |
mRNA Refseq | NM_153603 |
Protein Refseq | NP_705831 |
MIM | 606978 |
UniProt ID | P83436 |
◆ Recombinant Proteins | ||
COG7-1172R | Recombinant Rat COG7 Protein, His (Fc)-Avi-tagged | +Inquiry |
COG7-3711M | Recombinant Mouse COG7 Protein | +Inquiry |
COG7-1630H | Recombinant Human COG7 Protein, GST-tagged | +Inquiry |
COG7-4950C | Recombinant Chicken COG7 | +Inquiry |
COG7-160H | Recombinant Human COG7 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COG7-7382HCL | Recombinant Human COG7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COG7 Products
Required fields are marked with *
My Review for All COG7 Products
Required fields are marked with *
0
Inquiry Basket