Recombinant Human COL6A1 Protein, GST-tagged

Cat.No. : COL6A1-1659H
Product Overview : Human COL6A1 partial ORF ( AAH52575, 919 a.a. - 1028 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils. The basic structural unit of collagen VI is a heterotrimer of the alpha1(VI), alpha2(VI), and alpha3(VI) chains. The alpha2(VI) and alpha3(VI) chains are encoded by the COL6A2 and COL6A3 genes, respectively. The protein encoded by this gene is the alpha 1 subunit of type VI collagen (alpha1(VI) chain). Mutations in the genes that code for the collagen VI subunits result in the autosomal dominant disorder, Bethlem myopathy. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.84 kDa
AA Sequence : ALGYVTRFYREASSGAAKKRLLLFSDGNSQGATPAAIEKAVQEAQRAGIEIFVVVVGRQVNEPHIRVLVTGKTAEYDVAYGESHLFRVPSYQALLRGVFHQTVSRKVALG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COL6A1 collagen, type VI, alpha 1 [ Homo sapiens ]
Official Symbol COL6A1
Synonyms COL6A1; collagen, type VI, alpha 1; collagen alpha-1(VI) chain; alpha 1 (VI) chain (61 AA); collagen VI, alpha-1 polypeptide; OPLL;
Gene ID 1291
mRNA Refseq NM_001848
Protein Refseq NP_001839
MIM 120220
UniProt ID P12109

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL6A1 Products

Required fields are marked with *

My Review for All COL6A1 Products

Required fields are marked with *

0
cart-icon