Recombinant Human COL6A1 Protein, GST-tagged
Cat.No. : | COL6A1-1659H |
Product Overview : | Human COL6A1 partial ORF ( AAH52575, 919 a.a. - 1028 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils. The basic structural unit of collagen VI is a heterotrimer of the alpha1(VI), alpha2(VI), and alpha3(VI) chains. The alpha2(VI) and alpha3(VI) chains are encoded by the COL6A2 and COL6A3 genes, respectively. The protein encoded by this gene is the alpha 1 subunit of type VI collagen (alpha1(VI) chain). Mutations in the genes that code for the collagen VI subunits result in the autosomal dominant disorder, Bethlem myopathy. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | ALGYVTRFYREASSGAAKKRLLLFSDGNSQGATPAAIEKAVQEAQRAGIEIFVVVVGRQVNEPHIRVLVTGKTAEYDVAYGESHLFRVPSYQALLRGVFHQTVSRKVALG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COL6A1 collagen, type VI, alpha 1 [ Homo sapiens ] |
Official Symbol | COL6A1 |
Synonyms | COL6A1; collagen, type VI, alpha 1; collagen alpha-1(VI) chain; alpha 1 (VI) chain (61 AA); collagen VI, alpha-1 polypeptide; OPLL; |
Gene ID | 1291 |
mRNA Refseq | NM_001848 |
Protein Refseq | NP_001839 |
MIM | 120220 |
UniProt ID | P12109 |
◆ Recombinant Proteins | ||
COL6A1-117H | Recombinant Human COL6A1, MYC/DDK-tagged | +Inquiry |
COL6A1-343H | Recombinant Human COL6A1 Protein, His-tagged | +Inquiry |
Col6a1-344M | Recombinant Mouse Col6a1 Protein, His-tagged | +Inquiry |
COL6A1-9677HFL | Recombinant Full Length Human COL6A1, Flag-tagged | +Inquiry |
COL6A1-1767H | Recombinant Human COL6A1 Protein (Asn770-Gly1028), N-His tagged | +Inquiry |
◆ Native Proteins | ||
COL6A1-001B | Native Bovine COL6A1 Protein | +Inquiry |
COL6-116H | Native Human Collagen type VI | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL6A1 Products
Required fields are marked with *
My Review for All COL6A1 Products
Required fields are marked with *
0
Inquiry Basket