"COL6A2" Related Products

Expand
Expand

Recombinant Human COL6A2 protein, T7/His-tagged

Cat.No.: COL6A2-28H
Product Overview: Recombinant human Collagen VI extracellular domain cDNA (27 - 227 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGETELSVAQCTQRPVDIVFLLDGSERLGEQNFHKARRFVEQVARRLTLA RRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAIHEALETTQYLNSFSHVGAGVVHAINAIVRSPRGRARRHAE LSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR WIC
Purity: ≥90% (SDS-PAGE)
Applications: 1. May be used for in vitro various collagen VI / integrin binding regulation for cell lineage specific differentiations study coating with this protein.2. May be used for protein-protein interaction assay.3. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: COL6A2 collagen, type VI, alpha 2 [ Homo sapiens ]
Official Symbol: COL6A2
Synonyms: COL6A2; collagen, type VI, alpha 2; collagen alpha-2(VI) chain; collagen VI, alpha-2 polypeptide; human mRNA for collagen VI alpha-2 C-terminal globular domain; PP3610; FLJ46862; DKFZp586E1322;
Gene ID: 1292
mRNA Refseq: NM_001849
Protein Refseq: NP_001840
MIM: 120240
UniProt ID: P12110
Chromosome Location: 21q22.3
Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function: extracellular matrix structural constituent; protein binding; protein binding, bridging;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.