Recombinant Human COL6A3 protein(2841-2920 aa), C-His-tagged
Cat.No. : | COL6A3-2643H |
Product Overview : | Recombinant Human COL6A3 protein(P12111)(2841-2920 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2841-2920 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVTTTKPVTTTTKPVTTTTKPVTIINQPSVKPAAAKPAPAKPVAA |
◆ Recombinant Proteins | ||
COL6A3-1769H | Recombinant Human COL6A3 Protein (Gln26-Val214), N-His tagged | +Inquiry |
COL6A3-2643H | Recombinant Human COL6A3 protein(2841-2920 aa), C-His-tagged | +Inquiry |
COL6A3-264H | Recombinant Human COL6A3, His-tagged | +Inquiry |
Col6a3-342M | Recombinant Mouse Col6a3 Protein, His-tagged | +Inquiry |
COL6A3-341H | Recombinant Human COL6A3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL6A3 Products
Required fields are marked with *
My Review for All COL6A3 Products
Required fields are marked with *
0
Inquiry Basket