Recombinant Human COL6A3 protein, His-B2M-tagged
Cat.No. : | COL6A3-2362H |
Product Overview : | Recombinant Human COL6A3 protein(P12111 )(2853-3176aa), fused to N-terminal His-B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 2853-3176aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.5 kDa |
AA Sequence : | HKQVNVPNNVTSSPTSNPVTTTKPVTTTKPVTTTTKPVTTTTKPVTIINQPSVKPAAAKPAPAKPVAAKPVATKMATVRPPVAVKPATAAKPVAAKPAAVRPPAAAAAKPVATKPEVPRPQAAKPAATKPATTKPMVKMSREVQVFEITENSAKLHWERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGGLLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
◆ Recombinant Proteins | ||
COL6A3-7082C | Recombinant Chicken COL6A3 | +Inquiry |
COL6A3-2361H | Recombinant Human COL6A3 protein, His-SUMO-tagged | +Inquiry |
COL6A3-2643H | Recombinant Human COL6A3 protein(2841-2920 aa), C-His-tagged | +Inquiry |
COL6A3-2362H | Recombinant Human COL6A3 protein, His-B2M-tagged | +Inquiry |
COL6A3-264H | Recombinant Human COL6A3, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL6A3 Products
Required fields are marked with *
My Review for All COL6A3 Products
Required fields are marked with *
0
Inquiry Basket