Recombinant Human COL6A6 Protein (430-982 aa), His-SUMO-tagged
Cat.No. : | COL6A6-974H |
Product Overview : | Recombinant Human COL6A6 Protein (430-982 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 430-982 aa |
Description : | Collagen VI acts as a cell-binding protein. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 77.4 kDa |
AA Sequence : | VDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCHLVVLTNGMSKDSILEPANRLREEHIRVYAIGIKEANQTQLREIAGEEKRVYYVHDFDALKDIRNQVVQEICTEEACKEMKADIMFLVDSSGSIGPENFSKMKTFMKNLVSKSQIGPDRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGILVLAVGIDGANPVELLAMAGSSDKYFFVETFGGLKGIFSDV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | A6NMZ7 |
◆ Recombinant Proteins | ||
COL6A6-3750M | Recombinant Mouse COL6A6 Protein | +Inquiry |
COL6A6-1633H | Recombinant Human COL6A6 Protein (430-982 aa), His-tagged | +Inquiry |
COL6A6-1871M | Recombinant Mouse COL6A6 Protein, His (Fc)-Avi-tagged | +Inquiry |
COL6A6-974H | Recombinant Human COL6A6 Protein (430-982 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL6A6 Products
Required fields are marked with *
My Review for All COL6A6 Products
Required fields are marked with *
0
Inquiry Basket