Recombinant Human COL9A3 Protein, GST-tagged

Cat.No. : COL9A3-1665H
Product Overview : Human COL9A3 partial ORF ( NP_001844, 280 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia type 3. [provided by RefSeq, Jan 2010]
Molecular Mass : 32.23 kDa
AA Sequence : GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COL9A3 collagen, type IX, alpha 3 [ Homo sapiens ]
Official Symbol COL9A3
Synonyms COL9A3; collagen, type IX, alpha 3; collagen alpha-3(IX) chain; collagen type IX proteoglycan; DJ885L7.4.1; EDM3; FLJ90759; IDD; MED; collagen IX, alpha-3 polypeptide;
Gene ID 1299
mRNA Refseq NM_001853
Protein Refseq NP_001844
MIM 120270
UniProt ID Q14050

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL9A3 Products

Required fields are marked with *

My Review for All COL9A3 Products

Required fields are marked with *

0
cart-icon