Recombinant Human COL9A3 Protein, GST-tagged
| Cat.No. : | COL9A3-1665H |
| Product Overview : | Human COL9A3 partial ORF ( NP_001844, 280 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia type 3. [provided by RefSeq, Jan 2010] |
| Molecular Mass : | 32.23 kDa |
| AA Sequence : | GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COL9A3 collagen, type IX, alpha 3 [ Homo sapiens ] |
| Official Symbol | COL9A3 |
| Synonyms | COL9A3; collagen, type IX, alpha 3; collagen alpha-3(IX) chain; collagen type IX proteoglycan; DJ885L7.4.1; EDM3; FLJ90759; IDD; MED; collagen IX, alpha-3 polypeptide; |
| Gene ID | 1299 |
| mRNA Refseq | NM_001853 |
| Protein Refseq | NP_001844 |
| MIM | 120270 |
| UniProt ID | Q14050 |
| ◆ Recombinant Proteins | ||
| COL9A3-1680H | Recombinant Human COL9A3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| COL9A3-1665H | Recombinant Human COL9A3 Protein, GST-tagged | +Inquiry |
| COL9A3-2143HFL | Recombinant Full Length Human COL9A3 Protein, C-Flag-tagged | +Inquiry |
| COL9A3-6857C | Recombinant Chicken COL9A3 | +Inquiry |
| COL9A3-640H | Recombinant Human COL9A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COL9A3-7374HCL | Recombinant Human COL9A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL9A3 Products
Required fields are marked with *
My Review for All COL9A3 Products
Required fields are marked with *
