Recombinant Human COL9A3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COL9A3-1680H |
Product Overview : | COL9A3 MS Standard C13 and N15-labeled recombinant protein (NP_001844) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia type 3. |
Molecular Mass : | 63.6 kDa |
AA Sequence : | MAGPRACAPLLLLLLLGELLAAAGAQRVGLPGPPGPPGPPGKPGQDGIDGEAGPPGLPGPPGPKGAPGKPGKPGEAGLPGLPGVDGLTGRDGPPGPKGAPGERGSLGPPGPPGLGGKGLPGPPGEAGVSGPPGGIGLRGPPGPSGLPGLPGPPGPPGPPGHPGVLPEGATDLQCPSICPPGPPGPPGMPGFKGPTGYKGEQGEVGKDGEKGDPGPPGPAGLPGSVGLQGPRGLRGLPGPLGPPGDRGPIGFRGPPGIPGAPGKAGDRGERGPEGFRGPKGDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGLPGRAGSKGEKGERGRAGELGEAGPSGEPGVPGDAGMPGERGEAGHRGSAGALGPQGPPGAPGVRGFQGQKGSMGDPGLPGPQGLRGDVGDRGPGGAAGPKGDQGIAGSDGLPGDKGELGPSGLVGPKGESGSRGELGPKGTQGPNGTSGVQGVPGPPGPLGLQGVPGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRPGPAGPPGPPGPPGSIGHPGARGPPGYRGPTGELGDPGPRGNQGDRGDKGAAGAGLDGPEGDQGPQGPQGVPGTSKDGQDGAPGEPGPPGDPGLPGAIGAQGTPGICDTSACQGAVLGGVGEKSGSRSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COL9A3 collagen type IX alpha 3 chain [ Homo sapiens (human) ] |
Official Symbol | COL9A3 |
Synonyms | COL9A3; collagen, type IX, alpha 3; collagen alpha-3(IX) chain; collagen type IX proteoglycan; DJ885L7.4.1; EDM3; FLJ90759; IDD; MED; collagen IX, alpha-3 polypeptide; |
Gene ID | 1299 |
mRNA Refseq | NM_001853 |
Protein Refseq | NP_001844 |
MIM | 120270 |
UniProt ID | Q14050 |
◆ Recombinant Proteins | ||
COL9A3-2143HFL | Recombinant Full Length Human COL9A3 Protein, C-Flag-tagged | +Inquiry |
COL9A3-6857C | Recombinant Chicken COL9A3 | +Inquiry |
COL9A3-640H | Recombinant Human COL9A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
COL9A3-1665H | Recombinant Human COL9A3 Protein, GST-tagged | +Inquiry |
Col9a3-920M | Recombinant Mouse Col9a3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COL9A3-7374HCL | Recombinant Human COL9A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL9A3 Products
Required fields are marked with *
My Review for All COL9A3 Products
Required fields are marked with *
0
Inquiry Basket