Recombinant Human COLEC11 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COLEC11-6223H |
Product Overview : | COLEC11 MS Standard C13 and N15-labeled recombinant protein (NP_954705) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the collectin family of C-type lectins that possess collagen-like sequences and carbohydrate recognition domains. Collectins are secreted proteins that play important roles in the innate immune system by binding to carbohydrate antigens on microorganisms, facilitating their recognition and removal. The encoded protein binds to multiple sugars with a preference for fucose and mannose. Mutations in this gene are a cause of 3MC syndrome-2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Mass : | 29 kDa |
AA Sequence : | MTPALCRSSSLASKGMRERRETKAPPDGLEESAPREKKQSQPVVTASDISKRKCTSSFVEMGSQGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COLEC11 collectin sub-family member 11 [ Homo sapiens (human) ] |
Official Symbol | COLEC11 |
Synonyms | COLEC11; collectin sub-family member 11; MGC3279; |
Gene ID | 78989 |
mRNA Refseq | NM_199235 |
Protein Refseq | NP_954705 |
MIM | 612502 |
UniProt ID | Q9BWP8 |
◆ Recombinant Proteins | ||
COLEC11-1668H | Recombinant Human COLEC11 Protein, GST-tagged | +Inquiry |
COLEC11-1721Z | Recombinant Zebrafish COLEC11 | +Inquiry |
COLEC11-107M | Recombinant Mouse Colec11, His tagged | +Inquiry |
COLEC11-6223H | Recombinant Human COLEC11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COLEC11-2219H | Recombinant Human COLEC11 Protein (Gln26-Met271), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COLEC11-001MCL | Recombinant Mouse COLEC11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COLEC11 Products
Required fields are marked with *
My Review for All COLEC11 Products
Required fields are marked with *
0
Inquiry Basket