Recombinant Human COMMD3, His-tagged
Cat.No. : | COMMD3-28015TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-183 of Human COMMD3 with N terminal His tag; 183 amino acids, 21kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-183 a.a. |
Description : | COMMD3 is widely expressed, with highest expression in thymus. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 94 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQ ADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRA DKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQ NTDSPSYPEISFSCSMEQLQDLVGKLK |
Gene Name | COMMD3 COMM domain containing 3 [ Homo sapiens ] |
Official Symbol | COMMD3 |
Synonyms | COMMD3; COMM domain containing 3; C10orf8, chromosome 10 open reading frame 8; COMM domain-containing protein 3; BUP; |
Gene ID | 23412 |
mRNA Refseq | NM_012071 |
Protein Refseq | NP_036203 |
Uniprot ID | Q9UBI1 |
Chromosome Location | 10pter-q22.1 |
Function | protein binding; |
◆ Recombinant Proteins | ||
COMMD3-2859H | Recombinant Human COMMD3 protein, His-tagged | +Inquiry |
COMMD3-963R | Recombinant Rhesus monkey COMMD3 Protein, His-tagged | +Inquiry |
COMMD3-1876M | Recombinant Mouse COMMD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
COMMD3-1944Z | Recombinant Zebrafish COMMD3 | +Inquiry |
COMMD3-1526R | Recombinant Rat COMMD3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD3-7370HCL | Recombinant Human COMMD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COMMD3 Products
Required fields are marked with *
My Review for All COMMD3 Products
Required fields are marked with *
0
Inquiry Basket