Recombinant Human COMMD3 protein, His-tagged
Cat.No. : | COMMD3-2859H |
Product Overview : | Recombinant Human COMMD3 protein(18-195 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-195 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | COMMD3 COMM domain containing 3 [ Homo sapiens ] |
Official Symbol | COMMD3 |
Synonyms | COMMD3; COMM domain containing 3; C10orf8, chromosome 10 open reading frame 8; COMM domain-containing protein 3; BUP; protein Bup; C10orf8; FLJ45471; DKFZp686K0399; |
Gene ID | 23412 |
mRNA Refseq | NM_012071 |
Protein Refseq | NP_036203 |
UniProt ID | Q9UBI1 |
◆ Recombinant Proteins | ||
COMMD3-1526R | Recombinant Rat COMMD3 Protein | +Inquiry |
COMMD3-1876M | Recombinant Mouse COMMD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
COMMD3-1183R | Recombinant Rat COMMD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
COMMD3-1944Z | Recombinant Zebrafish COMMD3 | +Inquiry |
COMMD3-28015TH | Recombinant Human COMMD3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD3-7370HCL | Recombinant Human COMMD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COMMD3 Products
Required fields are marked with *
My Review for All COMMD3 Products
Required fields are marked with *
0
Inquiry Basket