Recombinant Full Length Human COMMD3 Protein, GST-tagged

Cat.No. : COMMD3-2218HF
Product Overview : Human COMMD3 full-length ORF ( AAH22898, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 195 amino acids
Description : COMMD3 (COMM Domain Containing 3) is a Protein Coding gene. Diseases associated with COMMD3 include Tarsal Tunnel Syndrome and Tibial Neuropathy. Among its related pathways are Innate Immune System.
Molecular Mass : 46.97 kDa
AA Sequence : MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COMMD3 COMM domain containing 3 [ Homo sapiens ]
Official Symbol COMMD3
Synonyms COMMD3; COMM domain containing 3; C10orf8, chromosome 10 open reading frame 8; COMM domain-containing protein 3; BUP; protein Bup; C10orf8; FLJ45471; DKFZp686K0399
Gene ID 23412
mRNA Refseq NM_012071
Protein Refseq NP_036203
MIM 616700
UniProt ID Q9UBI1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMMD3 Products

Required fields are marked with *

My Review for All COMMD3 Products

Required fields are marked with *

0
cart-icon
0
compare icon