Recombinant Human COMMD3 Protein, GST-tagged
Cat.No. : | COMMD3-1678H |
Product Overview : | Human COMMD3 full-length ORF ( AAH22898, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | COMMD3 (COMM Domain Containing 3) is a Protein Coding gene. Diseases associated with COMMD3 include Tarsal Tunnel Syndrome and Tibial Neuropathy. Among its related pathways are Innate Immune System. |
Molecular Mass : | 46.97 kDa |
AA Sequence : | MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COMMD3 COMM domain containing 3 [ Homo sapiens ] |
Official Symbol | COMMD3 |
Synonyms | COMMD3; COMM domain containing 3; C10orf8, chromosome 10 open reading frame 8; COMM domain-containing protein 3; BUP; protein Bup; C10orf8; FLJ45471; DKFZp686K0399; |
Gene ID | 23412 |
mRNA Refseq | NM_012071 |
Protein Refseq | NP_036203 |
MIM | 616700 |
UniProt ID | Q9UBI1 |
◆ Recombinant Proteins | ||
COMMD3-2218HF | Recombinant Full Length Human COMMD3 Protein, GST-tagged | +Inquiry |
COMMD3-1876M | Recombinant Mouse COMMD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
COMMD3-2859H | Recombinant Human COMMD3 protein, His-tagged | +Inquiry |
COMMD3-1944Z | Recombinant Zebrafish COMMD3 | +Inquiry |
COMMD3-1183R | Recombinant Rat COMMD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD3-7370HCL | Recombinant Human COMMD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD3 Products
Required fields are marked with *
My Review for All COMMD3 Products
Required fields are marked with *