Recombinant Human COMMD5 Protein, GST-tagged

• Cat.No.: COMMD5-1682H
• Product Overview: Human COMMD5 partial ORF ( NP_054785, 125 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: COMMD5 (COMM Domain Containing 5) is a Protein Coding gene.
• Molecular Mass: 36.74 kDa
• AA Sequence: DLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKRCERRLQD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COMMD5 COMM domain containing 5 [ Homo sapiens ]
• Official Symbol: COMMD5
• Synonyms: COMM domain containing 5; FLJ13008; HCaRG; HT002Hypertension-related calcium-regulated gene protein; COMM domain-containing protein 5HCARG; COMMD5
• Gene ID: 28991
• mRNA Refseq: NM_014066.3
• Protein Refseq: NP_054785.2
• MIM: 608216
• UniProt ID: Q9GZQ3