Recombinant Human COMMD5 Protein, GST-tagged
Cat.No. : | COMMD5-1682H |
Product Overview : | Human COMMD5 partial ORF ( NP_054785, 125 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | COMMD5 (COMM Domain Containing 5) is a Protein Coding gene. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKRCERRLQD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COMMD5 COMM domain containing 5 [ Homo sapiens ] |
Official Symbol | COMMD5 |
Synonyms | COMM domain containing 5; FLJ13008; HCaRG; HT002Hypertension-related calcium-regulated gene protein; COMM domain-containing protein 5HCARG; COMMD5 |
Gene ID | 28991 |
mRNA Refseq | NM_014066.3 |
Protein Refseq | NP_054785.2 |
MIM | 608216 |
UniProt ID | Q9GZQ3 |
◆ Recombinant Proteins | ||
Commd5-382R | Recombinant Rat Commd5 protein, His&Myc-tagged | +Inquiry |
COMMD5-0386H | Recombinant Human COMMD5 protein, His&Myc-tagged | +Inquiry |
COMMD5-3490H | Recombinant Human COMMD5 protein, His-tagged | +Inquiry |
Commd5-2250M | Recombinant Mouse Commd5 Protein, Myc/DDK-tagged | +Inquiry |
COMMD5-2691H | Recombinant Human COMMD5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD5-7369HCL | Recombinant Human COMMD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COMMD5 Products
Required fields are marked with *
My Review for All COMMD5 Products
Required fields are marked with *
0
Inquiry Basket