Recombinant Human COMMD5 Protein, GST-tagged

Cat.No. : COMMD5-1682H
Product Overview : Human COMMD5 partial ORF ( NP_054785, 125 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : COMMD5 (COMM Domain Containing 5) is a Protein Coding gene.
Molecular Mass : 36.74 kDa
AA Sequence : DLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKRCERRLQD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COMMD5 COMM domain containing 5 [ Homo sapiens ]
Official Symbol COMMD5
Synonyms COMM domain containing 5; FLJ13008; HCaRG; HT002Hypertension-related calcium-regulated gene protein; COMM domain-containing protein 5HCARG; COMMD5
Gene ID 28991
mRNA Refseq NM_014066.3
Protein Refseq NP_054785.2
MIM 608216
UniProt ID Q9GZQ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMMD5 Products

Required fields are marked with *

My Review for All COMMD5 Products

Required fields are marked with *

0
cart-icon
0
compare icon