Recombinant Human COMMD9 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | COMMD9-2711H | 
| Product Overview : | COMMD9 MS Standard C13 and N15-labeled recombinant protein (NP_054905) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. May down-regulate activation of NF-kappa-B. Modulates Na+ transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits. | 
| Molecular Mass : | 21.8 kDa | 
| AA Sequence : | MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASKTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | COMMD9 COMM domain containing 9 [ Homo sapiens (human) ] | 
| Official Symbol | COMMD9 | 
| Synonyms | COMMD9; COMM domain containing 9; HSPC166; C11orf55; LINC00610; COMM domain-containing protein 9 | 
| Gene ID | 29099 | 
| mRNA Refseq | NM_014186 | 
| Protein Refseq | NP_054905 | 
| MIM | 612299 | 
| UniProt ID | Q9P000 | 
| ◆ Recombinant Proteins | ||
| COMMD9-967R | Recombinant Rhesus monkey COMMD9 Protein, His-tagged | +Inquiry | 
| COMMD9-2711H | Recombinant Human COMMD9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| COMMD9-7180H | Recombinant Human COMM Domain Containing 9, His-tagged | +Inquiry | 
| COMMD9-1946HF | Recombinant Full Length Human COMMD9 Protein, GST-tagged | +Inquiry | 
| COMMD9-5538Z | Recombinant Zebrafish COMMD9 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| COMMD9-7366HCL | Recombinant Human COMMD9 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD9 Products
Required fields are marked with *
My Review for All COMMD9 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            