Recombinant Human COMMD9 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COMMD9-2711H |
Product Overview : | COMMD9 MS Standard C13 and N15-labeled recombinant protein (NP_054905) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. May down-regulate activation of NF-kappa-B. Modulates Na+ transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits. |
Molecular Mass : | 21.8 kDa |
AA Sequence : | MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COMMD9 COMM domain containing 9 [ Homo sapiens (human) ] |
Official Symbol | COMMD9 |
Synonyms | COMMD9; COMM domain containing 9; HSPC166; C11orf55; LINC00610; COMM domain-containing protein 9 |
Gene ID | 29099 |
mRNA Refseq | NM_014186 |
Protein Refseq | NP_054905 |
MIM | 612299 |
UniProt ID | Q9P000 |
◆ Recombinant Proteins | ||
COMMD9-7180H | Recombinant Human COMM Domain Containing 9, His-tagged | +Inquiry |
COMMD9-1686H | Recombinant Human COMMD9 Protein, GST-tagged | +Inquiry |
COMMD9-5538Z | Recombinant Zebrafish COMMD9 | +Inquiry |
COMMD9-1946HF | Recombinant Full Length Human COMMD9 Protein, GST-tagged | +Inquiry |
COMMD9-2711H | Recombinant Human COMMD9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD9-7366HCL | Recombinant Human COMMD9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD9 Products
Required fields are marked with *
My Review for All COMMD9 Products
Required fields are marked with *