Recombinant Human COMT

Cat.No. : COMT-27960TH
Product Overview : Recombinant fragment of Human COMT ; 221aa, 24.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 221 amino acids
Description : Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters.
Molecular Weight : 24.400kDa
Tissue specificity : Brain, liver, placenta, lymphocytes and erythrocytes.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:10% Glycerol, 0.01% Magnesium chloride, 0.32% Tris HCl
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAM NVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLL SPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQ DIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLL RKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEY REVVDGLEKAIYKGPGSEAGP
Sequence Similarities : Belongs to the mammalian catechol-O-methyltransferase family.
Gene Name COMT catechol-O-methyltransferase [ Homo sapiens ]
Official Symbol COMT
Synonyms COMT; catechol-O-methyltransferase; catechol O-methyltransferase;
Gene ID 1312
mRNA Refseq NM_000754
Protein Refseq NP_000745
Uniprot ID P21964
Chromosome Location 22q11.21
Pathway Biogenic Amine Synthesis, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Dopamine clearance from the synaptic cleft, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem;
Function O-methyltransferase activity; catechol O-methyltransferase activity; magnesium ion binding; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMT Products

Required fields are marked with *

My Review for All COMT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon