Recombinant Human COMT protein, GST-tagged
| Cat.No. : | COMT-088H |
| Product Overview : | Recombinant Human COMT protein(NP_000745)(1-182 aa), fused with GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-182 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | COMT catechol-O-methyltransferase [ Homo sapiens ] |
| Official Symbol | COMT |
| Synonyms | COMT; catechol-O-methyltransferase; catechol O-methyltransferase; |
| Gene ID | 1312 |
| mRNA Refseq | NM_000754 |
| Protein Refseq | NP_000745 |
| UniProt ID | P21964 |
| ◆ Recombinant Proteins | ||
| RFL11362RF | Recombinant Full Length Rat Catechol O-Methyltransferase(Comt) Protein, His-Tagged | +Inquiry |
| COMT-1707H | Active Recombinant Human COMT Protein, His-tagged | +Inquiry |
| Comt-828M | Recombinant Mouse Comt Protein, His-tagged | +Inquiry |
| COMT-126H | Recombinant Human Catechol-O-methyltransferase, His-tagged | +Inquiry |
| COMT-015H | Recombinant Human COMT Protein, His/SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COMT-121HKCL | Human COMT Knockdown Cell Lysate | +Inquiry |
| COMT-7365HCL | Recombinant Human COMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMT Products
Required fields are marked with *
My Review for All COMT Products
Required fields are marked with *
