Recombinant Human COMT protein, GST-tagged
Cat.No. : | COMT-088H |
Product Overview : | Recombinant Human COMT protein(NP_000745)(1-182 aa), fused with GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-182 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | COMT catechol-O-methyltransferase [ Homo sapiens ] |
Official Symbol | COMT |
Synonyms | COMT; catechol-O-methyltransferase; catechol O-methyltransferase; |
Gene ID | 1312 |
mRNA Refseq | NM_000754 |
Protein Refseq | NP_000745 |
UniProt ID | P21964 |
◆ Recombinant Proteins | ||
COMT-543H | Recombinant Human COMT Protein (Met51-Pro271) | +Inquiry |
COMT-4987H | Recombinant Human COMT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Comt-1671R | Recombinant Rat Comt protein, His-tagged | +Inquiry |
COMT-793R | Recombinant Rhesus Macaque COMT Protein, His (Fc)-Avi-tagged | +Inquiry |
COMT-1707H | Active Recombinant Human COMT Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMT-7365HCL | Recombinant Human COMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMT Products
Required fields are marked with *
My Review for All COMT Products
Required fields are marked with *