Recombinant Human COPB1, His-tagged
Cat.No. : | COPB1-27477TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 607-953 of Human beta COP with N terminal His tag; MWt 43 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 607-953 a.a. |
Description : | This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 130 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAK LEEEKLSQKKESEKRNVTVQPDDPISFMQLTAKNEMNC KEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGF SDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLEL ATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIF GNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDA EFRQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMK CLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKP IHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTS I |
Gene Name | COPB1 coatomer protein complex, subunit beta 1 [ Homo sapiens ] |
Official Symbol | COPB1 |
Synonyms | COPB1; coatomer protein complex, subunit beta 1; coatomer protein complex, subunit beta , COPB; coatomer subunit beta; |
Gene ID | 1315 |
mRNA Refseq | NM_001144061 |
Protein Refseq | NP_001137533 |
MIM | 600959 |
Uniprot ID | P53618 |
Chromosome Location | 11p15.2 |
Pathway | COPI Mediated Transport, organism-specific biosystem; Golgi to ER Retrograde Transport, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
Function | protein binding; structural molecule activity; |
◆ Recombinant Proteins | ||
COPB1-1692H | Recombinant Human COPB1 Protein, GST-tagged | +Inquiry |
COPB1-3803H | Recombinant Human COPB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COPB1-1186R | Recombinant Rat COPB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPB1-301421H | Recombinant Human COPB1 protein, GST-tagged | +Inquiry |
COPB1-3774M | Recombinant Mouse COPB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPB1-7363HCL | Recombinant Human COPB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPB1 Products
Required fields are marked with *
My Review for All COPB1 Products
Required fields are marked with *