Recombinant Human COPB1 Protein, GST-tagged
Cat.No. : | COPB1-1692H |
Product Overview : | Human COPB partial ORF ( NP_057535, 854 a.a. - 953 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | TVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COPB1 coatomer protein complex, subunit beta 1 [ Homo sapiens ] |
Official Symbol | COPB1 |
Synonyms | COPB1; coatomer protein complex, subunit beta 1; coatomer protein complex, subunit beta , COPB; coatomer subunit beta; beta-cop; beta coat protein; beta-coat protein; COPB; FLJ10341; FLJ46444; FLJ57957; DKFZp761K102; |
Gene ID | 1315 |
mRNA Refseq | NM_001144061 |
Protein Refseq | NP_001137533 |
MIM | 600959 |
UniProt ID | P53618 |
◆ Recombinant Proteins | ||
COPB1-3803H | Recombinant Human COPB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COPB1-1186R | Recombinant Rat COPB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPB1-3823H | Recombinant Human COPB1 protein, His-tagged | +Inquiry |
COPB1-1606C | Recombinant Chicken COPB1 | +Inquiry |
COPB1-3774M | Recombinant Mouse COPB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPB1-7363HCL | Recombinant Human COPB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPB1 Products
Required fields are marked with *
My Review for All COPB1 Products
Required fields are marked with *