Recombinant Human COPB1 Protein, GST-tagged

Cat.No. : COPB1-1692H
Product Overview : Human COPB partial ORF ( NP_057535, 854 a.a. - 953 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]
Molecular Mass : 36.74 kDa
AA Sequence : TVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COPB1 coatomer protein complex, subunit beta 1 [ Homo sapiens ]
Official Symbol COPB1
Synonyms COPB1; coatomer protein complex, subunit beta 1; coatomer protein complex, subunit beta , COPB; coatomer subunit beta; beta-cop; beta coat protein; beta-coat protein; COPB; FLJ10341; FLJ46444; FLJ57957; DKFZp761K102;
Gene ID 1315
mRNA Refseq NM_001144061
Protein Refseq NP_001137533
MIM 600959
UniProt ID P53618

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COPB1 Products

Required fields are marked with *

My Review for All COPB1 Products

Required fields are marked with *

0
cart-icon