Recombinant Human COPS2 Protein, GST-tagged
| Cat.No. : | COPS2-1700H |
| Product Overview : | Human COPS2 full-length ORF ( NP_004227.1, 1 a.a. - 443 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | COPS2 (COP9 Signalosome Subunit 2) is a Protein Coding gene. Diseases associated with COPS2 include Persistent Hyperplastic Primary Vitreous. Among its related pathways are Vesicle-mediated transport and Clathrin-mediated endocytosis. GO annotations related to this gene include signal transducer activity and transcription corepressor activity. An important paralog of this gene is PSMD11. |
| Molecular Mass : | 78 kDa |
| AA Sequence : | MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COPS2 COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) [ Homo sapiens ] |
| Official Symbol | COPS2 |
| Synonyms | COPS2; COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis); COP9 signalosome complex subunit 2; ALIEN; CSN2; TRIP15; TRIP-15; alien homolog; signalosome subunit 2; TR-interacting protein 15; JAB1-containing signalosome subunit 2; thyroid receptor interacting protein 15; thyroid receptor-interacting protein 15; SGN2; |
| Gene ID | 9318 |
| mRNA Refseq | NM_001143887 |
| Protein Refseq | NP_001137359 |
| MIM | 604508 |
| UniProt ID | P61201 |
| ◆ Recombinant Proteins | ||
| Cops2-923M | Recombinant Mouse Cops2 Protein, MYC/DDK-tagged | +Inquiry |
| COPS2-289Z | Recombinant Zebrafish COPS2 | +Inquiry |
| COPS2-971R | Recombinant Rhesus monkey COPS2 Protein, His-tagged | +Inquiry |
| COPS2-1189R | Recombinant Rat COPS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| COPS2-1954HF | Recombinant Full Length Human COPS2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COPS2-7359HCL | Recombinant Human COPS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPS2 Products
Required fields are marked with *
My Review for All COPS2 Products
Required fields are marked with *



