Recombinant Human COPS2 Protein, GST-tagged
Cat.No. : | COPS2-1700H |
Product Overview : | Human COPS2 full-length ORF ( NP_004227.1, 1 a.a. - 443 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | COPS2 (COP9 Signalosome Subunit 2) is a Protein Coding gene. Diseases associated with COPS2 include Persistent Hyperplastic Primary Vitreous. Among its related pathways are Vesicle-mediated transport and Clathrin-mediated endocytosis. GO annotations related to this gene include signal transducer activity and transcription corepressor activity. An important paralog of this gene is PSMD11. |
Molecular Mass : | 78 kDa |
AA Sequence : | MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COPS2 COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) [ Homo sapiens ] |
Official Symbol | COPS2 |
Synonyms | COPS2; COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis); COP9 signalosome complex subunit 2; ALIEN; CSN2; TRIP15; TRIP-15; alien homolog; signalosome subunit 2; TR-interacting protein 15; JAB1-containing signalosome subunit 2; thyroid receptor interacting protein 15; thyroid receptor-interacting protein 15; SGN2; |
Gene ID | 9318 |
mRNA Refseq | NM_001143887 |
Protein Refseq | NP_001137359 |
MIM | 604508 |
UniProt ID | P61201 |
◆ Recombinant Proteins | ||
COPS2-2278H | Recombinant Human COPS2 Protein (Met1-Ala443), N-His tagged | +Inquiry |
COPS2-4570H | Recombinant Human COPS2 protein | +Inquiry |
COPS2-2296Z | Recombinant Zebrafish COPS2 Protein (1-443 aa), His-tagged | +Inquiry |
COPS2-25H | Recombinant Human COPS2 protein, GST-tagged | +Inquiry |
COPS2-2307H | Recombinant Human COPS2 Protein (1-443 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPS2-7359HCL | Recombinant Human COPS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COPS2 Products
Required fields are marked with *
My Review for All COPS2 Products
Required fields are marked with *
0
Inquiry Basket