Recombinant Human COPS8, His-tagged
Cat.No. : | COPS8-26339TH |
Product Overview : | Recombinant full length Human COPS8 with an N terminal His tag ; mwt: 25.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 209 amino acids |
Description : | The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Conjugation : | HIS |
Molecular Weight : | 25.300kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:10% Glycerol, 2.4% Urea, 0.32% Tris HCl |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN |
Sequence Similarities : | Belongs to the CSN8 family.Contains 1 PCI domain. |
Gene Name | COPS8 COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) [ Homo sapiens ] |
Official Symbol | COPS8 |
Synonyms | COPS8; COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis); COP9 signalosome complex subunit 8; COP9; CSN8; MGC1297; SGN8; |
Gene ID | 10920 |
mRNA Refseq | NM_006710 |
Protein Refseq | NP_006701 |
Uniprot ID | Q99627 |
Chromosome Location | 2q37.3 |
◆ Recombinant Proteins | ||
COPS8-1710H | Recombinant Human COPS8 Protein, GST-tagged | +Inquiry |
COPS8-1893M | Recombinant Mouse COPS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPS8-1970HF | Recombinant Full Length Human COPS8 Protein, GST-tagged | +Inquiry |
COPS8-3502C | Recombinant Chicken COPS8 | +Inquiry |
Cops8-380M | Recombinant Mouse Cops8 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPS8-7352HCL | Recombinant Human COPS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COPS8 Products
Required fields are marked with *
My Review for All COPS8 Products
Required fields are marked with *
0
Inquiry Basket